Loading...
Statistics
Advertisement

Soundlightz.org

Domain is redirected to: Soundlightz.de
Advertisement
Conversion Technology Metas Server
Soundlightz.org is hosted in Germany . Soundlightz.org doesn't use HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 16. First javascripts: Jquery.js, Jquery-migrate.min.js, Wow.js, Number of used analytics tools: 0. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Soundlightz.org

Technology

Number of occurences: 9
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery
  • Lightbox
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 16
  • jquery.js
  • jquery-migrate.min.js
  • wow.js
  • SmoothScroll.js
  • parallax.js
  • jquery.scrollTo.min.js
  • jquery.localScroll.min.js
  • jquery.nav.js
  • jquery.bxslider.min.js
  • jquery.easing.min.js
  • jquery.fitvids.js
  • jquery.actual.min.js
  • nivo-lightbox.min.js
  • skip-link-focus-fix.js
  • custom.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Social

Number of occurences: 1
  • Facebook Box

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Soundlightz.org

Missing HTTPS protocol.

    Meta - Soundlightz.org

    Number of occurences: 3
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: generator
      Content: WordPress 4.4.4

    Server / Hosting

    • IP: 134.0.28.51
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • dyn1.direktdomains.de
    • dyn2.direktdomains.de
    • soundlightz.org

    Target

    • technik.netzreform.de

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Mon, 25 Jul 2016 11:34:13 GMT Server: Apache Location: http://www.soundlightz.de Vary: Accept-Encoding Content-Length: 0 Content-Type: text/html X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 OK Date: Mon, 25 Jul 2016 11:34:20 GMT Server: Apache/2.4.20 (Unix) OpenSSL/1.0.1e mod_fcgid/2.3.9 Link: ; rel="https://api.w.org/" Vary: User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

    DNS

    host: soundlightz.org
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 80.190.216.117
    host: soundlightz.org
    1. class: IN
    2. ttl: 84600
    3. type: NS
    4. target: dyn1.direktdomains.de
    host: soundlightz.org
    1. class: IN
    2. ttl: 84600
    3. type: NS
    4. target: dyn2.direktdomains.de
    host: soundlightz.org
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: dyn1.direktdomains.de
    5. rname: technik.netzreform.de
    6. serial: 2016011801
    7. refresh: 86400
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 86400
    host: soundlightz.org
    1. class: IN
    2. ttl: 84600
    3. type: MX
    4. pri: 10
    5. target: soundlightz.org

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.oundlightz.org, www.seoundlightz.org, www.eoundlightz.org, www.swoundlightz.org, www.woundlightz.org, www.sdoundlightz.org, www.doundlightz.org, www.sxoundlightz.org, www.xoundlightz.org, www.sfoundlightz.org, www.foundlightz.org, www.sgoundlightz.org, www.goundlightz.org, www.stoundlightz.org, www.toundlightz.org, www.sundlightz.org, www.sobundlightz.org, www.sbundlightz.org, www.sohundlightz.org, www.shundlightz.org, www.sogundlightz.org, www.sgundlightz.org, www.sojundlightz.org, www.sjundlightz.org, www.somundlightz.org, www.smundlightz.org, www.so undlightz.org, www.s undlightz.org, www.sovundlightz.org, www.svundlightz.org, www.sondlightz.org, www.souwndlightz.org, www.sowndlightz.org, www.souendlightz.org, www.soendlightz.org, www.sousndlightz.org, www.sosndlightz.org, www.souandlightz.org, www.soandlightz.org, www.soudlightz.org, www.sounndlightz.org, www.soundlightz.org, www.sounhdlightz.org, www.souhdlightz.org, www.sounjdlightz.org, www.soujdlightz.org, www.sounkdlightz.org, www.soukdlightz.org, www.sounldlightz.org, www.souldlightz.org, www.soun dlightz.org, www.sou dlightz.org, www.sounlightz.org, www.soundtlightz.org, www.sountlightz.org, www.soundglightz.org, www.sounglightz.org, www.soundblightz.org, www.sounblightz.org, www.soundxlightz.org, www.sounxlightz.org, www.soundslightz.org, www.sounslightz.org, www.soundflightz.org, www.sounflightz.org, www.soundvlightz.org, www.sounvlightz.org, www.soundylightz.org, www.sounylightz.org, www.soundzlightz.org, www.sounzlightz.org, www.soundalightz.org, www.sounalightz.org, www.soundelightz.org, www.sounelightz.org, www.soundrlightz.org, www.sounrlightz.org, www.soundightz.org, www.soundluightz.org, www.sounduightz.org, www.soundl8ightz.org, www.sound8ightz.org, www.soundl9ightz.org, www.sound9ightz.org, www.soundljightz.org, www.soundjightz.org, www.soundl0ightz.org, www.sound0ightz.org, www.soundlmightz.org, www.soundmightz.org, www.soundlpightz.org, www.soundpightz.org, www.soundloightz.org, www.soundoightz.org, www.soundlghtz.org, www.soundlirghtz.org, www.soundlrghtz.org, www.soundlifghtz.org, www.soundlfghtz.org, www.soundlivghtz.org, www.soundlvghtz.org, www.soundlikghtz.org, www.soundlkghtz.org, www.soundli,ghtz.org, www.soundl,ghtz.org, www.soundlibghtz.org, www.soundlbghtz.org, www.soundligghtz.org, www.soundlgghtz.org, www.soundlitghtz.org, www.soundltghtz.org, www.soundliyghtz.org, www.soundlyghtz.org, www.soundliughtz.org, www.soundlughtz.org, www.soundlijghtz.org, www.soundljghtz.org, www.soundlimghtz.org, www.soundlmghtz.org, www.soundlinghtz.org, www.soundlnghtz.org, www.soundlihtz.org, www.soundligshtz.org, www.soundlishtz.org, www.soundligxhtz.org, www.soundlixhtz.org, www.soundligyhtz.org, www.soundliyhtz.org, www.soundlighhtz.org, www.soundlihhtz.org, www.soundlignhtz.org, www.soundlinhtz.org, www.soundligchtz.org, www.soundlichtz.org, www.soundligdhtz.org, www.soundlidhtz.org, www.soundligehtz.org, www.soundliehtz.org, www.soundligrhtz.org, www.soundlirhtz.org, www.soundligthtz.org, www.soundlithtz.org, www.soundligbhtz.org, www.soundlibhtz.org, www.soundligvhtz.org, www.soundlivhtz.org, www.soundligtz.org, www.soundlighetz.org, www.soundligetz.org, www.soundlighdtz.org, www.soundligdtz.org, www.soundlighctz.org, www.soundligctz.org, www.soundlighutz.org, www.soundligutz.org, www.soundlighjtz.org, www.soundligjtz.org, www.soundlightz.org, www.soundligtz.org, www.soundlighbtz.org, www.soundligbtz.org, www.soundlighgtz.org, www.soundliggtz.org,

    Other websites we recently analyzed

    1. 60 Sekunden Optionen
      60 Sekunden Optionen Tool gratis 30 Tage testen
      Germany - 85.13.140.187
      Server software: Apache
      Technology: CSS, Html, Javascript
      Number of meta tags: 25
    2. naxal.ru - Diese Website steht zum Verkauf! - Informationen zum Thema naxal.
      Diese Website steht zum Verkauf! naxal.ru ist Ihre erste und beste Informationsquelle über naxal Hier finden Sie auch weitere interessante Links. Wir hoffen, dass Sie bei Ihrer Suche erfolgreich sind!
      Germany - 82.98.86.169
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    3. 介護資格≪おすすめ求人≫
      今から介護資格を取りにいこうと思ってます。
      Osaka (Japan) - 112.78.200.16
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 3
    4. Psychiatry Port Orange, Florida
      Psychiatrist, Psychiatry, Therapy, Counseling, Psychotherapy, Depression, Anxiety, ADHD, Obsessive Compulsive Disorder, Stress Management, OCD, PTSD
      Ashburn (United States) - 54.236.189.61
      G Analytics ID: UA-49148900-1
      Server software: openresty/1.7.4.1
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Google Analytics
      Number of Javascript: 10
      Number of meta tags: 4
    5. keechains.org
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    6. kellerwilliamsrealtyservices.com
      Chicago (United States) - 184.154.247.147
      Server software: nginx
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 22
      Number of meta tags: 3
    7. Julian Scheffer
      Julian Scheffer - I am currently pursuing a Ph.D. in Social Psychology at the Pennsylvania State University. I completed my undergrad at the University of Toronto where I obtained a Hon. B.Sc in Neuroscience and Psychology.
      San Francisco (United States) - 104.18.48.189
      G Analytics ID: UA-64569494-2
      Server software: cloudflare-nginx
      Technology: CSS, Html, Html5, Javascript, SVG, Google Analytics, Twitter Button
      Number of Javascript: 3
      Number of meta tags: 5
    8. VÃ¥gan Havnevesen KF
      Vågan havnevesens ansvarsområde omfatter hele kommunens kystlinje med tilhørende havner. Innefor havnedistriktet finnes 15 større og mindre havner med Svolvær som hovedhavn for kommunen og regionen. Andre havner med viktighet for kommunen og havnevesenet er: Digermulen, Skrova, Kabelvåg, Henningsvær, Hopen, Kleppstad, Hovsund og Laukvik.Vågan kommune ligger i et av landets viktigste områder for fiskeri og oppdrett, og er også et nasjonalt satsningsområde for turisme. Havnevesenets primære målsetning er å si
      Norway - 213.162.240.23
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 13
      Number of meta tags: 4
    9. psicopatologia.es
      Spain - 37.247.121.15
      Server software: Apache
      Technology: Html
    10. Welcome!
      Russian Federation - 193.124.179.237
      Server software: nginx/1.10.1
      Technology: Html, Html5, Javascript
      Number of meta tags: 1

    Check Other Websites